PDB entry 1p5q

View 1p5q on RCSB PDB site
Description: Crystal Structure of FKBP52 C-terminal Domain
Class: isomerase
Keywords: isomerase
Deposited on 2003-04-28, released 2004-06-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.212
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FK506-binding protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02790 (22-End)
      • expression tag (21)
      • modified residue (87)
      • modified residue (137)
      • conflict (233)
    Domains in SCOPe 2.06: d1p5qa1, d1p5qa2, d1p5qa3
  • Chain 'B':
    Compound: FK506-binding protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02790 (22-End)
      • expression tag (21)
      • modified residue (87)
      • modified residue (137)
      • conflict (233)
    Domains in SCOPe 2.06: d1p5qb1, d1p5qb2, d1p5qb3
  • Chain 'C':
    Compound: FK506-binding protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02790 (22-End)
      • expression tag (21)
      • modified residue (87)
      • modified residue (137)
      • conflict (233)
    Domains in SCOPe 2.06: d1p5qc1, d1p5qc2, d1p5qc3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p5qA (A:)
    mgsshhhhhhssglvprgshmeedggiirriqtrgegyakpnegaivevalegyykdklf
    dqrelrfeigegenldlpygleraiqrmekgehsivylkpsyafgsvgkekfqippnael
    kyelhlksfekakeswemnseekleqstivkergtvyfkegkykqallqykkivswleye
    ssfsneeaqkaqalrlashlnlamchlklqafsaaiescnkaleldsnnekglsrrgeah
    lavndfelaradfqkvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeen
    kakaeassgdhptdtemkeeqksntagsqsqvetea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p5qA (A:)
    eedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldlpygl
    eraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekakeswemnse
    ekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqalrlashln
    lamchlklqafsaaiescnkaleldsnnekglsrrgeahlavndfelaradfqkvlqlyp
    nnkaaktqlavcqqrirrqlarekklyanmferlaeeenkaka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p5qB (B:)
    mgsshhhhhhssglvprgshmeedggiirriqtrgegyakpnegaivevalegyykdklf
    dqrelrfeigegenldlpygleraiqrmekgehsivylkpsyafgsvgkekfqippnael
    kyelhlksfekakeswemnseekleqstivkergtvyfkegkykqallqykkivswleye
    ssfsneeaqkaqalrlashlnlamchlklqafsaaiescnkaleldsnnekglsrrgeah
    lavndfelaradfqkvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeen
    kakaeassgdhptdtemkeeqksntagsqsqvetea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p5qB (B:)
    eedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldlpygl
    eraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekakeswemnse
    ekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqalrlashln
    lamchlklqafsaaiescnkaleldsnnekglsrrgeahlavndfelaradfqkvlqlyp
    nnkaaktqlavcqqrirrqlarekklyanmferlaeeenkaka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p5qC (C:)
    mgsshhhhhhssglvprgshmeedggiirriqtrgegyakpnegaivevalegyykdklf
    dqrelrfeigegenldlpygleraiqrmekgehsivylkpsyafgsvgkekfqippnael
    kyelhlksfekakeswemnseekleqstivkergtvyfkegkykqallqykkivswleye
    ssfsneeaqkaqalrlashlnlamchlklqafsaaiescnkaleldsnnekglsrrgeah
    lavndfelaradfqkvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeen
    kakaeassgdhptdtemkeeqksntagsqsqvetea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p5qC (C:)
    eedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldlpygl
    eraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekakeswemnse
    ekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqalrlashln
    lamchlklqafsaaiescnkaleldsnnekglsrrgeahlavndfelaradfqkvlqlyp
    nnkaaktqlavcqqrirrqlarekklyanmferlaeeenkaka