PDB entry 1p5q

View 1p5q on RCSB PDB site
Description: Crystal Structure of FKBP52 C-terminal Domain
Deposited on 2003-04-28, released 2004-06-22
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-22, with a file datestamp of 2004-06-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.212
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p5qA (A:)
    mgsshhhhhhssglvprgshmeedggiirriqtrgegyakpnegaivevalegyykdklf
    dqrelrfeigegenldlpygleraiqrmekgehsivylkpsyafgsvgkekfqippnael
    kyelhlksfekakeswemnseekleqstivkergtvyfkegkykqallqykkivswleye
    ssfsneeaqkaqalrlashlnlamchlklqafsaaiescnkaleldsnnekglsrrgeah
    lavndfelaradfqkvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeen
    kakaeassgdhptdtemkeeqksntagsqsqvetea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p5qA (A:)
    eedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldlpygl
    eraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekakeswemnse
    ekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqalrlashln
    lamchlklqafsaaiescnkaleldsnnekglsrrgeahlavndfelaradfqkvlqlyp
    nnkaaktqlavcqqrirrqlarekklyanmferlaeeenkaka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p5qB (B:)
    mgsshhhhhhssglvprgshmeedggiirriqtrgegyakpnegaivevalegyykdklf
    dqrelrfeigegenldlpygleraiqrmekgehsivylkpsyafgsvgkekfqippnael
    kyelhlksfekakeswemnseekleqstivkergtvyfkegkykqallqykkivswleye
    ssfsneeaqkaqalrlashlnlamchlklqafsaaiescnkaleldsnnekglsrrgeah
    lavndfelaradfqkvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeen
    kakaeassgdhptdtemkeeqksntagsqsqvetea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p5qB (B:)
    eedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldlpygl
    eraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekakeswemnse
    ekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqalrlashln
    lamchlklqafsaaiescnkaleldsnnekglsrrgeahlavndfelaradfqkvlqlyp
    nnkaaktqlavcqqrirrqlarekklyanmferlaeeenkaka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p5qC (C:)
    mgsshhhhhhssglvprgshmeedggiirriqtrgegyakpnegaivevalegyykdklf
    dqrelrfeigegenldlpygleraiqrmekgehsivylkpsyafgsvgkekfqippnael
    kyelhlksfekakeswemnseekleqstivkergtvyfkegkykqallqykkivswleye
    ssfsneeaqkaqalrlashlnlamchlklqafsaaiescnkaleldsnnekglsrrgeah
    lavndfelaradfqkvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeen
    kakaeassgdhptdtemkeeqksntagsqsqvetea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p5qC (C:)
    eedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldlpygl
    eraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekakeswemnse
    ekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqalrlashln
    lamchlklqafsaaiescnkaleldsnnekglsrrgeahlavndfelaradfqkvlqlyp
    nnkaaktqlavcqqrirrqlarekklyanmferlaeeenkaka