PDB entry 1p5j

View 1p5j on RCSB PDB site
Description: Crystal Structure Analysis of Human Serine Dehydratase
Class: lyase
Keywords: lyase
Deposited on 2003-04-27, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.189
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-serine dehydratase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20132
      • engineered (305)
    Domains in SCOPe 2.07: d1p5ja_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p5jA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmmsgeplhvktpirdsmalskmag
    tsvylkmdsaqpsgsfkirgighfckrwakqgcahfvcssagnagmaaayaarqlgvpat
    ivvpgttpaltierlknegatckvvgelldeafelakalaknnpgwvyippfddpliweg
    hasivkelketlwekpgaialsvggggllcgvvqglqecgwgdvpviametfgahsfhaa
    ttagklvslpkitsvakalgvktvgsqalklfqehpifsevisdqeavaaiekfvddeki
    lvepacgaalaavyshviqklqlegnlrtplpslvvivcggsnislaqlralkeqlgmtn
    rlpklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p5jA (A:)
    geplhvktpirdsmalskmagtsvylkmdsaqpsgsfkirgighfckrwakqgcahfvcs
    sagnagmaaayaarqlgvpativvpgttpaltierlknegatckvvgelldeafelakal
    aknnpgwvyippfddpliweghasivkelketlwekpgaialsvggggllcgvvqglqec
    gwgdvpviametfgahsfhaattagklvslpkitsvakalgvktvgsqalklfqehpifs
    evisdqeavaaiekfvddekilvepacgaalaavyshviqklqlegnlrtplpslvvivc
    ggsnislaqlralkeqlgm