PDB entry 1p57

View 1p57 on RCSB PDB site
Description: Extracellular domain of human hepsin
Class: hydrolase/hydrolase inhibitor
Keywords: srcr, scavenger receptor cysteine-rich domain, serine protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2003-04-25, released 2004-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine protease hepsin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05981 (Start-113)
      • engineered (66)
    Domains in SCOPe 2.07: d1p57a_
  • Chain 'B':
    Compound: Serine protease hepsin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p57b_
  • Heterogens: CR4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p57A (A:)
    sdqeplypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseld
    vrtagaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p57A (A:)
    plypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseldvrta
    gaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p57B (B:)
    ivggrdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagav
    aqasphglqlgvqavvyhggylpfrdpnseensndialvhlssplplteyiqpvclpaag
    qalvdgkictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagyp
    eggidacqgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifq
    aikthseasgmvtql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p57B (B:)
    ivggrdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagav
    aqasphglqlgvqavvyhggylpfnsndialvhlssplplteyiqpvclpaagqalvdgk
    ictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagypeggidac
    qgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifqaikthse
    asgmvtq