PDB entry 1p4w

View 1p4w on RCSB PDB site
Description: Solution structure of the DNA-binding domain of the Erwinia amylovora RcsB protein
Class: DNA binding protein
Keywords: RcsB protein, solution structure, DNA binding domain, DNA BINDING PROTEIN
Deposited on 2003-04-24, released 2003-06-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rcsB
    Species: Erwinia amylovora [TaxId:552]
    Gene: RSCB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p4wa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1p4wA (A:)
mrgshhhhhhgsytpesvakllekisaggygdkrlspkesevlrlfaegflvteiakkln
rsiktissqkksammklgvdndiallnylssvsmtpvdk

    Sequence, based on observed residues (ATOM records): (download) 
    >1p4wA (A:)
ytpesvakllekisaggygdkrlspkesevlrlfaegflvteiakklnrsiktissqkks
ammklgvdndiallnylssvsmtpvdk