PDB entry 1p4u

View 1p4u on RCSB PDB site
Description: crystal structure of gga3 gae domain in complex with rabaptin-5 peptide
Class: protein transport
Keywords: protein transport
Deposited on 2003-04-24, released 2003-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor binding protein gga3
    Species: Homo sapiens [TaxId:9606]
    Gene: GGA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ52 (Start-152)
      • engineered (63)
      • engineered (77)
    Domains in SCOPe 2.07: d1p4ua_
  • Chain 'B':
    Compound: Rabaptin-5
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p4uA (A:)
    gsppkgpelslasihvplesikpssalpvtaydkngfrilfhfakecppgrpdvlvvvvs
    mlnmaplpvksivlqaaapksmkvklqppsgtelspfspiqppaaitqvmllanplkekv
    rlrykltfalgeqlstevgevdqfppveqwgnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p4uA (A:)
    lslasihvplesikpssalpvtaydkngfrilfhfakecppgrpdvlvvvvsmlnmaplp
    vksivlqaaapksmkvklqppsgtelspfspiqppaaitqvmllanplkekvrlrykltf
    algeqlstevgevdqfppveqwgnl
    

  • Chain 'B':
    No sequence available.