PDB entry 1p4s

View 1p4s on RCSB PDB site
Description: Solution structure of Mycobacterium tuberculosis adenylate kinase
Class: transferase
Keywords: alpha/beta, TRANSFERASE
Deposited on 2003-04-24, released 2004-01-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: ADK OR RV0733 OR MT0757 OR MTV041.07
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p4sa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p4sA (A:)
    mrvlllgppgagkgtqavklaeklgipqistgelfrrnieegtklgveakryldagdlvp
    sdltnelvddrlnnpdaangfildgyprsveqakalhemlerrgtdidavlefrvseevl
    lerlkgrgraddtddvilnrmkvyrdetaplleyyrdqlktvdavgtmdevfaralralg
    k