PDB entry 1p4q

View 1p4q on RCSB PDB site
Description: Solution structure of the CITED2 transactivation domain in complex with the p300 CH1 domain
Class: transcription/transferase
Keywords: helix, protein-protein complex, TRANSCRIPTION/TRANSFERASE COMPLEX
Deposited on 2003-04-23, released 2003-07-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cbp/p300-interacting transactivator 2
  Species: Homo sapiens [TaxId:9606]
  Gene: CITED2 OR MRG1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99967 (8-51)
    • cloning artifact (0-7)
  Domains in SCOPe 2.03: d1p4qa_
• Chain 'B':
  Compound: E1A-associated protein p300
  Species: Homo sapiens [TaxId:9606]
  Gene: EP300 OR P300
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q09472 (0-100)
  Domains in SCOPe 2.03: d1p4qb_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p4qA (A:)
  gsgsgsgsnvidtdfideevlmslviemgldrikelpelwlgqnefdfmtdf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p4qB (B:)
  mgsgahtadpekrkliqqqlvlllhahkcqrreqangevrqcnlphcrtmknvlnhmthc
  qsgkscqvahcassrqiishwknctrhdcpvclplknagdk