PDB entry 1p4q

View 1p4q on RCSB PDB site
Description: Solution structure of the CITED2 transactivation domain in complex with the p300 CH1 domain
Class: transcription/transferase
Keywords: helix, protein-protein complex, TRANSCRIPTION/TRANSFERASE COMPLEX
Deposited on 2003-04-23, released 2003-07-01
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cbp/p300-interacting transactivator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CITED2 OR MRG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99967 (8-51)
      • cloning artifact (0-7)
    Domains in SCOPe 2.02: d1p4qa_
  • Chain 'B':
    Compound: E1A-associated protein p300
    Species: Homo sapiens [TaxId:9606]
    Gene: EP300 OR P300
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1p4qb_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p4qA (A:)
    gsgsgsgsnvidtdfideevlmslviemgldrikelpelwlgqnefdfmtdf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p4qB (B:)
    mgsgahtadpekrkliqqqlvlllhahkcqrreqangevrqcnlphcrtmknvlnhmthc
    qsgkscqvahcassrqiishwknctrhdcpvclplknagdk