PDB entry 1p4q

View 1p4q on RCSB PDB site
Description: solution structure of the cited2 transactivation domain in complex with the p300 ch1 domain
Deposited on 2003-04-23, released 2003-07-01
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-01, with a file datestamp of 2003-07-01.
Experiment type: NMR17
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1p4qa_
  • Chain 'B':
    Domains in SCOP 1.65: d1p4qb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1p4qA (A:)
gsgsgsgsnvidtdfideevlmslviemgldrikelpelwlgqnefdfmtdf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1p4qB (B:)
mgsgahtadpekrkliqqqlvlllhahkcqrreqangevrqcnlphcrtmknvlnhmthc
qsgkscqvahcassrqiishwknctrhdcpvclplknagdk