PDB entry 1p4n

View 1p4n on RCSB PDB site
Description: Crystal Structure of Weissella viridescens FemX:UDP-MurNAc-pentapeptide complex
Class: ligase
Keywords: FemX,Ligase
Deposited on 2003-04-23, released 2004-02-10
The last revision prior to the SCOP 1.73 freeze date was dated 2004-02-17, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.172
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FemX
    Species: Weissella viridescens
    Gene: femx
    Database cross-references and differences (RAF-indexed):
    • GB AAG21689 (0-334)
    Domains in SCOP 1.73: d1p4na1, d1p4na2
  • Chain 'B':
    Compound: UDP-MurNAc-pentapeptide
    Species: synthetic, synthetic
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p4nA (A:)
    pvlnlndpqaveryeefmrqspygqvtqdlgwakvknnwepvdvyleddqgaiiaamsml
    lgdtptdkkfayaskgpvmdvtdvdlldrlvdeavkaldgrayvlrfdpevaysdefntt
    lqdhgyvtrnrnvadagmhatiqprlnmvldltkfpdakttldlypsktkskikrpfrdg
    vevhsgnsateldeffktyttmaerhgithrpieyfqrmqaafdadtmrifvaeregkll
    stgialkygrkiwymyagsmdgntyyapyavqsemiqwaldtntdlydlggiesestdds
    lyvfkhvfvkdapreyigeidkvldpevyaelvkd
    

  • Chain 'B':
    No sequence available.