PDB entry 1p4n

View 1p4n on RCSB PDB site
Description: Crystal Structure of Weissella viridescens FemX:UDP-MurNAc-pentapeptide complex
Deposited on 2003-04-23, released 2004-02-10
The last revision prior to the SCOP 1.69 freeze date was dated 2004-02-17, with a file datestamp of 2004-02-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.172
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p4nA (A:)
    pvlnlndpqaveryeefmrqspygqvtqdlgwakvknnwepvdvyleddqgaiiaamsml
    lgdtptdkkfayaskgpvmdvtdvdlldrlvdeavkaldgrayvlrfdpevaysdefntt
    lqdhgyvtrnrnvadagmhatiqprlnmvldltkfpdakttldlypsktkskikrpfrdg
    vevhsgnsateldeffktyttmaerhgithrpieyfqrmqaafdadtmrifvaeregkll
    stgialkygrkiwymyagsmdgntyyapyavqsemiqwaldtntdlydlggiesestdds
    lyvfkhvfvkdapreyigeidkvldpevyaelvkd