PDB entry 1p4m

View 1p4m on RCSB PDB site
Description: crystal structure of riboflavin kinase
Class: transferase
Keywords: beta barrel, riboflavin kinase, flavin mononucleotide
Deposited on 2003-04-23, released 2003-05-13
The last revision prior to the SCOP 1.73 freeze date was dated 2003-05-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Riboflavin kinase
    Species: HOMO SAPIENS
    Gene: FLJ11149
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q969G6 (0-146)
      • conflict (133)
    Domains in SCOP 1.73: d1p4ma_
  • Heterogens: MG, ADP, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p4mA (A:)
    rhlpyfcrgqvvrgfgrgskqlgiptanfpeqvvdnlpadistgiyygwasvgsgdvhkm
    vvsigwnpyykntkksmethimhtfkedfygeilnvaivgylrpeknfdsleslisaiqg
    dieeakkrlelpeylkikednffqvsk