PDB entry 1p4e

View 1p4e on RCSB PDB site
Description: Flpe W330F mutant-DNA Holliday Junction Complex
Class: DNA binding protein/recombination/DNA
Keywords: Flp, Holliday junction, site-specific recombination, W330, Flpe, DNA BINDING PROTEIN-RECOMBINATION-DNA COMPLEX
Deposited on 2003-04-23, released 2003-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.236
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Recombinase FLP protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FLP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03870 (0-End)
      • see remark 999 (0)
      • polymorphism (3)
      • see remark 999 (31)
      • see remark 999 (106)
      • see remark 999 (292)
      • engineered (328)
    Domains in SCOPe 2.07: d1p4ea1, d1p4ea2
  • Chain 'B':
    Compound: Recombinase FLP protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FLP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03870 (0-421)
      • see remark 999 (0)
      • polymorphism (3)
      • see remark 999 (31)
      • see remark 999 (106)
      • see remark 999 (292)
      • engineered (328)
      • expression tag (422-428)
    Domains in SCOPe 2.07: d1p4eb1, d1p4eb2, d1p4eb3
  • Chain 'C':
    Compound: Recombinase FLP protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FLP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03870 (0-420)
      • see remark 999 (0)
      • polymorphism (3)
      • see remark 999 (31)
      • see remark 999 (106)
      • see remark 999 (292)
      • engineered (328)
    Domains in SCOPe 2.07: d1p4ec1, d1p4ec2
  • Chain 'D':
    Compound: Recombinase FLP protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FLP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03870 (0-420)
      • see remark 999 (0)
      • polymorphism (3)
      • see remark 999 (31)
      • see remark 999 (106)
      • see remark 999 (292)
      • engineered (328)
    Domains in SCOPe 2.07: d1p4ed1, d1p4ed2
  • Chain 'E':
    Compound: 5'-d(*tp*ap*ap*gp*tp*tp*cp*cp*tp*ap*tp*tp*c)-3'
  • Chain 'F':
    Compound: 5'-d(*tp*ap*ap*gp*tp*tp*cp*cp*tp*ap*tp*tp*c)-3'
  • Chain 'G':
    Compound: 33-mer
  • Chain 'H':
    Compound: 33-mer
  • Chain 'I':
    Compound: 5'-d(*tp*tp*tp*ap*ap*ap*ap*gp*ap*ap*tp*ap*gp*gp*ap*ap*cp*tp*tp*c)-3'
  • Chain 'J':
    Compound: 5'-d(*tp*tp*tp*ap*ap*ap*ap*gp*ap*ap*tp*ap*gp*gp*ap*ap*cp*tp*tp*c)-3'
  • Heterogens: 2PO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p4eA (A:)
    sqfdilcktppkvlvrqfverferpsgekiascaaeltylcwmithngtaikratfmsyn
    tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipyngqkhqsditdivs
    slqlqfesseeadkgnshskkmlkallsegesiweitekilnsfeytsrftktktlyqfl
    flatfincgrfsdiknvdpksfklvqnkylgviiqclvtetktsvsrhiyffsargridp
    lvyldeflrnsepvlkrvnrtgnsssnkqeyqllkdnlvrsynkalkknapypifaikng
    pkshigrhlmtsflsmkglteltnvvgnfsdkrasavarttythqitaipdhyfalvsry
    yaydpiskemialkdetnpieewqhieqlkgsaegsirypawngiisqevldylssyinr
    righhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p4eA (A:)
    sqfdilcktppkvlvrqfverferpsgekiascaaeltylcwmithngtaikratfmsyn
    tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipyngqsditdivsslq
    lqfesgnshskkmlkallsegesiweitekilnsfeytsrftktktlyqflflatfincg
    rfsdiknvdpksfklvqnkylgviiqclvtetktsvsrhiyffsargridplvyldeflr
    nsepvlkrvnrtgnsssnkqeyqllkdnlvrsynkalkknapypifaikngpkshigrhl
    mtsflsmkglteltnvvgnfsdkqitaipdhyfalvsryyaydpiskemialkdetnpie
    ewqhieqlkgsaegsirypawngiisqevldylssyinrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p4eB (B:)
    sqfdilcktppkvlvrqfverferpsgekiascaaeltylcwmithngtaikratfmsyn
    tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipyngqkhqsditdivs
    slqlqfesseeadkgnshskkmlkallsegesiweitekilnsfeytsrftktktlyqfl
    flatfincgrfsdiknvdpksfklvqnkylgviiqclvtetktsvsrhiyffsargridp
    lvyldeflrnsepvlkrvnrtgnsssnkqeyqllkdnlvrsynkalkknapypifaikng
    pkshigrhlmtsflsmkglteltnvvgnfsdkrasavarttythqitaipdhyfalvsry
    yaydpiskemialkdetnpieewqhieqlkgsaegsirypawngiisqevldylssyinr
    righhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p4eB (B:)
    sqfdilcktppkvlvrqfverferpsgekiascaaeltylcwmithngtaikratfmsyn
    tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipyngqksditdivssl
    qlqfesgnshskkmlkallsegesiweitekilnsfeytsrftktktlyqflflatfinc
    grfsdiknvdpksfklvqnkylgviiqclvtetktsvsrhiyffsargridplvyldefl
    rnsepvlkrvnrtgnsssnkqeyqllkdnlvrsynkalkknapypifaikngpkshigrh
    lmtsflsmkglteltnvvgnfsdttythqitaipdhyfalvsryyaydpiskemialkde
    tnpieewqhieqlkgsaegsirypawngiisqevldylssyinrrighhhhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p4eC (C:)
    sqfdilcktppkvlvrqfverferpsgekiascaaeltylcwmithngtaikratfmsyn
    tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipyngqkhqsditdivs
    slqlqfesseeadkgnshskkmlkallsegesiweitekilnsfeytsrftktktlyqfl
    flatfincgrfsdiknvdpksfklvqnkylgviiqclvtetktsvsrhiyffsargridp
    lvyldeflrnsepvlkrvnrtgnsssnkqeyqllkdnlvrsynkalkknapypifaikng
    pkshigrhlmtsflsmkglteltnvvgnfsdkrasavarttythqitaipdhyfalvsry
    yaydpiskemialkdetnpieewqhieqlkgsaegsirypawngiisqevldylssyinr
    righhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p4eC (C:)
    sqfdilcktppkvlvrqfverferpsgekiascaaeltylcwmithngtaikratfmsyn
    tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipynsditdivsslqlq
    fesnshskkmlkallsegesiweitekilnsfeytsrftktktlyqflflatfincgrfs
    diknvdpksfklvqnkylgviiqclvtetktsvsrhiyffsargridplvyldeflrnse
    pvlkrvnrtgnkqeyqllkdnlvrsynkalkknapypifaikngpkshigrhlmtsflsm
    kglteltnvvgnfsdkrasavarttythqitaipdhyfalvsryyaydpiskemialkde
    tnpieewqhieqegsirypawngiisqevldylssyinrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1p4eD (D:)
    sqfdilcktppkvlvrqfverferpsgekiascaaeltylcwmithngtaikratfmsyn
    tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipyngqkhqsditdivs
    slqlqfesseeadkgnshskkmlkallsegesiweitekilnsfeytsrftktktlyqfl
    flatfincgrfsdiknvdpksfklvqnkylgviiqclvtetktsvsrhiyffsargridp
    lvyldeflrnsepvlkrvnrtgnsssnkqeyqllkdnlvrsynkalkknapypifaikng
    pkshigrhlmtsflsmkglteltnvvgnfsdkrasavarttythqitaipdhyfalvsry
    yaydpiskemialkdetnpieewqhieqlkgsaegsirypawngiisqevldylssyinr
    righhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p4eD (D:)
    sqfdilcktppkvlvrqfverferpsgekiascaaeltylcwmithngtaikratfmsyn
    tiisnslsfdivnkslqfkyktqkatileaslkklipaweftiipynsditdivsslqlq
    fessgnshskkmlkallsegesiweitekilnsfeytsrftktktlyqflflatfincgr
    fsdiknvdpksfklvqnkylgviiqclvtetktsvsrhiyffsargridplvyldeflrn
    sepvlkrvnrtgnsnkqeyqllkdnlvrsynkalkknapypifaikngpkshigrhlmts
    flsmkglteltnvvgnfsdkrasavarttythqitaipdhyfalvsryyaydpiskemia
    lkdetnpieewqhieqlkgsaegsirypawngiisqevldylssyinrr
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.