PDB entry 1p4d

View 1p4d on RCSB PDB site
Description: F factor TraI Relaxase Domain
Class: hydrolase
Keywords: 5-strand antiparallel beta sheet, alpha-beta, 3 histidine Mg(II) coordination, HYDROLASE
Deposited on 2003-04-22, released 2003-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TraI protein
    Species: Escherichia coli [TaxId:562]
    Gene: traI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p4da_
  • Chain 'B':
    Compound: TraI protein
    Species: Escherichia coli [TaxId:562]
    Gene: traI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p4db_
  • Chain 'C':
    Compound: TraI protein
    Species: Escherichia coli [TaxId:562]
    Gene: traI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p4dc_
  • Heterogens: MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p4dA (A:)
    mmsiaqvrsagsagnyytdkdnyyvlgsmgerwagrgaeqlglqgsvdkdvftrllegrl
    pdgadlsrmqdgsnrhrpgydltfsapksvsmmamlggdkrlidahnqavdfavrqveal
    astrvmtdgqsetvltgnlvmalfnhdtsrdqepqlhthavvanvtqhngewktlssdkv
    gktgfienvyanqiafgrlyreklkeqvealgyetevvgkhgmwempgvpveafsgrsqt
    ireavgedaslksrdvaaldtrkskqhvdpeikmaewmqtlketgfdirayrdaadqrad
    lrtltpgpasqdgpdvqqavtqaiaglser
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p4dA (A:)
    mmsiaqvrsagsagnyytdkdnyyvlgsmgerwagrgaeqlglqgsvdkdvftrllegrl
    pdgadlsrmqdgsnrhrpgydltfsapksvsmmamlggdkrlidahnqavdfavrqveal
    astrvmtdgqsetvltgnlvmalfnhdtsrdqepqlhthavvanvtqhngewktlssdkv
    gktgfienvyanqiafgrlyreklkeqvealgyetevvgkhgmwempgvpveafsvdpei
    kmaewmqtlketgfdirayrdaadqradlrtltpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p4dB (B:)
    mmsiaqvrsagsagnyytdkdnyyvlgsmgerwagrgaeqlglqgsvdkdvftrllegrl
    pdgadlsrmqdgsnrhrpgydltfsapksvsmmamlggdkrlidahnqavdfavrqveal
    astrvmtdgqsetvltgnlvmalfnhdtsrdqepqlhthavvanvtqhngewktlssdkv
    gktgfienvyanqiafgrlyreklkeqvealgyetevvgkhgmwempgvpveafsgrsqt
    ireavgedaslksrdvaaldtrkskqhvdpeikmaewmqtlketgfdirayrdaadqrad
    lrtltpgpasqdgpdvqqavtqaiaglser
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p4dB (B:)
    mmsiaqvrsagsagnyytdkdnyyvlgsmgerwagrgaeqlglqgsvdkdvftrllegrl
    pdgadlsrmqdgsnrhrpgydltfsapksvsmmamlggdkrlidahnqavdfavrqveal
    astrvmtdgqsetvltgnlvmalfnhdtsrdqepqlhthavvanvtqhngewktlssdkv
    gktgfienvyanqiafgrlyreklkeqvealgyetevvgkhgmwempgvpveafshvdpe
    ikmaewmqtlketgfdirayrdaadqradlrtltpg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p4dC (C:)
    mmsiaqvrsagsagnyytdkdnyyvlgsmgerwagrgaeqlglqgsvdkdvftrllegrl
    pdgadlsrmqdgsnrhrpgydltfsapksvsmmamlggdkrlidahnqavdfavrqveal
    astrvmtdgqsetvltgnlvmalfnhdtsrdqepqlhthavvanvtqhngewktlssdkv
    gktgfienvyanqiafgrlyreklkeqvealgyetevvgkhgmwempgvpveafsgrsqt
    ireavgedaslksrdvaaldtrkskqhvdpeikmaewmqtlketgfdirayrdaadqrad
    lrtltpgpasqdgpdvqqavtqaiaglser
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p4dC (C:)
    mmsiaqvrsagsagnyytdkdnyyvlgsmgerwagrgaeqlglqgsvdkdvftrllegrl
    pdgadlsrmqdgsnrhrpgydltfsapksvsmmamlggdkrlidahnqavdfavrqveal
    astrvmtdgqsetvltgnlvmalfnhdtsrdqepqlhthavvanvtqhngewktlssdkv
    gktgfienvyanqiafgrlyreklkeqvealgyetevvgkhgmwempgvpveafshvdpe
    ikmaewmqtlketgfdirayrdaadqradlrtltpg