PDB entry 1p4b

View 1p4b on RCSB PDB site
Description: Three-Dimensional Structure Of a Single Chain Fv Fragment Complexed With The peptide GCN4(7P-14P).
Class: immune system
Keywords: Fv antibody, antigen peptide binder, scFv, picomolar binder, IMMUNE SYSTEM
Deposited on 2003-04-22, released 2004-05-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.219
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Antibody Variable heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p4bh_
  • Chain 'L':
    Compound: Antibody Variable light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p4bl_
  • Chain 'P':
    Compound: GCN4(7P-14P) peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1P4B (0-11)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1p4bH (H:)
    dvqlqqsgpglvapsqslsitctvsgfsltdygvnwvrqspgkglewlgviwgdgitdyn
    salksrlsvtkdnsksqvflkmnslqsgdsaryycvtglfdywgqgttltvssasgadhh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p4bH (H:)
    dvqlqqsgpglvapsqslsitctvsgfsltdygvnwvrqspgkglewlgviwgdgitdyn
    salksrlsvtkdnsksqvflkmnslqsgdsaryycvtglfdywgqgttltvs
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1p4bL (L:)
    madyadavvtqesalttspgetvtltcrsstgavttsnyaswvqekpdhlftgliggtnn
    rapgvparfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgggggs
    ggggsggggsggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p4bL (L:)
    adavvtqesalttspgetvtltcrsstgavttsnyaswvqekpdhlftgliggtnnrapg
    vparfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl
    

  • Chain 'P':
    No sequence available.