PDB entry 1p4a

View 1p4a on RCSB PDB site
Description: Crystal Structure of the PurR complexed with cPRPP
Class: transcription
Keywords: transcription
Deposited on 2003-04-22, released 2003-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.18
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pur operon repressor
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PURR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p4aa1, d1p4aa2
  • Chain 'B':
    Compound: pur operon repressor
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PURR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p4ab1, d1p4ab2
  • Chain 'C':
    Compound: pur operon repressor
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PURR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p4ac1, d1p4ac2
  • Chain 'D':
    Compound: pur operon repressor
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PURR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p4ad1, d1p4ad2
  • Heterogens: PCP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p4aA (A:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgss
    nriqtmslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvde
    rlvdeymslltlstinmkeksieiqngnflrffkdnllkngetes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p4aA (A:)
    kfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtllt
    vpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgkl
    fasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdstvsinyvsgssnriqtms
    lakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvdeym
    slltlstinmkeksieiqngnflrffkdn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p4aB (B:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgss
    nriqtmslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvde
    rlvdeymslltlstinmkeksieiqngnflrffkdnllkngetes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p4aB (B:)
    kfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtllt
    vpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgkl
    fasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdegstvsinyvsgssnriqt
    mslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvde
    ymslltlstinmkeksieiqngnflrff
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p4aC (C:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgss
    nriqtmslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvde
    rlvdeymslltlstinmkeksieiqngnflrffkdnllkngetes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p4aC (C:)
    kfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtllt
    vpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgkl
    fasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdnegstvsinyvsgssnriq
    tmslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvd
    eymslltlstinmkeksieiqngnflrff
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1p4aD (D:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgss
    nriqtmslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvde
    rlvdeymslltlstinmkeksieiqngnflrffkdnllkngetes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p4aD (D:)
    kfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtllt
    vpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgkl
    fasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdegstvsinyvsgssnriqt
    mslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvde
    ymslltlstinmkeksieiqngnflrff