PDB entry 1p43

View 1p43 on RCSB PDB site
Description: reverse protonation is the key to general acid-base catalysis in enolase
Deposited on 2003-04-21, released 2003-11-18
The last revision prior to the SCOP 1.71 freeze date was dated 2003-11-18, with a file datestamp of 2003-11-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p43A (A:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggshaggalalqqfmiaptgaktfa
    ealrigsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgk
    vkigldcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfae
    ddweawshffktagiqivaddltvtnpkriataiekkaadalllkvnqigtlsesikaaq
    dsfaagwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelg
    dnavfagenfhhgdkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p43B (B:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggshaggalalqqfmiaptgaktfa
    ealrigsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgk
    vkigldcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfae
    ddweawshffktagiqivaddltvtnpkriataiekkaadalllkvnqigtlsesikaaq
    dsfaagwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelg
    dnavfagenfhhgdkl