PDB entry 1p41

View 1p41 on RCSB PDB site
Description: Crystal Structure of the Purine operon repressor of Bacillus Subtilis
Class: DNA binding protein
Keywords: Purine operon repressor, Helix-turn-helix domain, Phosphoribosyltranseferases, Domain recombination, DNA binding, Transcription regulation
Deposited on 2003-04-20, released 2003-08-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2003-08-26, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.1
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pur operon repressor
    Species: Bacillus subtilis
    Gene: PURR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p41a1, d1p41a2
  • Chain 'B':
    Compound: pur operon repressor
    Species: Bacillus subtilis
    Gene: PURR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p41b1, d1p41b2
  • Chain 'C':
    Compound: pur operon repressor
    Species: Bacillus subtilis
    Gene: PURR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p41c1, d1p41c2
  • Chain 'D':
    Compound: pur operon repressor
    Species: Bacillus subtilis
    Gene: PURR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p41d1, d1p41d2
  • Heterogens: SO4, EPE, P6G, 2PE, PG4, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p41A (A:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgss
    nriqtmslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvde
    rlvdeymslltlstinmkeksieiqngnflrffkdnllkngeteshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p41A (A:)
    kfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtllt
    vpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgkl
    fasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdgstvsinyvsgssnriqtm
    slakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvdey
    mslltlstinmkeksieiqngnflrffkdn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p41B (B:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgss
    nriqtmslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvde
    rlvdeymslltlstinmkeksieiqngnflrffkdnllkngeteshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p41B (B:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdgstvsinyvsgssnriqt
    mslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvde
    ymslltlstinmkeksieiqngnflrffk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p41C (C:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgss
    nriqtmslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvde
    rlvdeymslltlstinmkeksieiqngnflrffkdnllkngeteshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p41C (C:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdgstvsinyvsgssnriqt
    mslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvde
    ymslltlstinmkeksieiqngnflrffk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1p41D (D:)
    mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
    tvpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgk
    lfasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgss
    nriqtmslakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvde
    rlvdeymslltlstinmkeksieiqngnflrffkdnllkngeteshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p41D (D:)
    kfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtllt
    vpgaaggvkyipkmkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgkl
    fasvfaereidvvmtvatkgiplayaaasylnvpvvivrkdgstvsinyvsgssnriqtm
    slakrsmktgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvdey
    mslltlstinmkeksieiqngnflrffkdn