PDB entry 1p3u

View 1p3u on RCSB PDB site
Description: Crystal Structures of the NO-and CO-Bound Heme Oxygenase From Neisseria Meningitidis: Implications for Oxygen Activation
Class: oxidoreductase
Keywords: heme oxygenase, heme degradation, OXIDOREDUCTASE
Deposited on 2003-04-18, released 2003-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.252
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 1
    Species: Neisseria meningitidis [TaxId:487]
    Gene: hemO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p3ua_
  • Heterogens: HEM, NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p3uA (A:)
    msetenqaltfakrlkadttavhdsvdnlvmsvqpfvskenyikflklqsvfhkavdhiy
    kdaelnkaipeleymarydavtqdlkdlgeepykfdkelpyeagnkaigwlycaegsnlg
    aaflfkhaqkldyngehgarhlaphpdgrgkhwrafvehlnalnltpeaeaeaiqgarea
    fafykvvlretfglaadaeapegmmphrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3uA (A:)
    altfakrlkadttavhdsvdnlvmsvqpfvskenyikflklqsvfhkavdhiykdaelnk
    aipeleymarydavtqdlkdlgeepykfdkelpyeagnkaigwlycaegsnlgaaflfkh
    aqkldyngehgarhlaphpdgrgkhwrafvehlnalnltpeaeaeaiqgareafafykvv
    lretfglaadaeapegmmp