PDB entry 1p3r

View 1p3r on RCSB PDB site
Description: Crystal structure of the phosphotyrosin binding domain(PTB) of mouse Disabled 1(Dab1)
Class: signaling protein
Keywords: PTB, signaling protein
Deposited on 2003-04-18, released 2003-08-05
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.223
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disabled homolog 2
    Species: MUS MUSCULUS
    Gene: DAB2 OR DOC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98078 (1-End)
      • initiating methionine (0)
    Domains in SCOP 1.73: d1p3ra_
  • Chain 'B':
    Compound: Disabled homolog 2
    Species: MUS MUSCULUS
    Gene: DAB2 OR DOC2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1p3rb_
  • Chain 'C':
    Compound: Disabled homolog 2
    Species: MUS MUSCULUS
    Gene: DAB2 OR DOC2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1p3rc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p3rA (A:)
    mektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkq
    riwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaikt
    gqqaeplvvdlkdlfqviynvkkkeedkkkveeankaeen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3rA (A:)
    mektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkq
    riwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaikt
    gqqaeplvvdlkdlfqviynvkkkeedk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p3rB (B:)
    mektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkq
    riwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaikt
    gqqaeplvvdlkdlfqviynvkkkeedkkkveeankaeen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3rB (B:)
    ektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkqr
    iwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaiktg
    qqaeplvvdlkdlfqviynvkkkeedkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p3rC (C:)
    mektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkq
    riwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaikt
    gqqaeplvvdlkdlfqviynvkkkeedkkkveeankaeen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3rC (C:)
    ektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkqr
    iwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaiktg
    qqaeplvvdlkdlfqviynvkkkeed