PDB entry 1p3r

View 1p3r on RCSB PDB site
Description: Crystal structure of the phosphotyrosin binding domain(PTB) of mouse Disabled 1(Dab1)
Deposited on 2003-04-18, released 2003-08-05
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-05, with a file datestamp of 2003-08-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.223
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1p3ra_
  • Chain 'B':
    Domains in SCOP 1.67: d1p3rb_
  • Chain 'C':
    Domains in SCOP 1.67: d1p3rc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p3rA (A:)
    mektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkq
    riwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaikt
    gqqaeplvvdlkdlfqviynvkkkeedkkkveeankaeen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3rA (A:)
    mektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkq
    riwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaikt
    gqqaeplvvdlkdlfqviynvkkkeedk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p3rB (B:)
    mektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkq
    riwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaikt
    gqqaeplvvdlkdlfqviynvkkkeedkkkveeankaeen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3rB (B:)
    ektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkqr
    iwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaiktg
    qqaeplvvdlkdlfqviynvkkkeedkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p3rC (C:)
    mektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkq
    riwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaikt
    gqqaeplvvdlkdlfqviynvkkkeedkkkveeankaeen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3rC (C:)
    ektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkqr
    iwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaiktg
    qqaeplvvdlkdlfqviynvkkkeed