PDB entry 1p3o

View 1p3o on RCSB PDB site
Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
Deposited on 2003-04-17, released 2004-02-24
The last revision prior to the SCOP 1.69 freeze date was dated 2004-02-24, with a file datestamp of 2004-02-24.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.224
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1p3oa_
  • Chain 'B':
    Domains in SCOP 1.69: d1p3ob_
  • Chain 'C':
    Domains in SCOP 1.69: d1p3oc_
  • Chain 'D':
    Domains in SCOP 1.69: d1p3od_
  • Chain 'E':
    Domains in SCOP 1.69: d1p3oe_
  • Chain 'F':
    Domains in SCOP 1.69: d1p3of_
  • Chain 'G':
    Domains in SCOP 1.69: d1p3og_
  • Chain 'H':
    Domains in SCOP 1.69: d1p3oh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p3oA (A:)
    artkqtarkstggkaprkqlatkaarksapatgeskkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3oA (A:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p3oB (B:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggakrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3oB (B:)
    vlrdniqgitkpairrlarrggakrisgliyeetrgvlkvflenvirdavtytehakrkt
    vtamdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p3oC (C:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    esaksaksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3oC (C:)
    aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
    kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1p3oD (D:)
    pepaksapapkkgskkavtktqkkdgkkrrksrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3oD (D:)
    kesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsre
    iqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1p3oE (E:)
    artkqtarkstggkaprkqlatkaarksapatgeskkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3oE (E:)
    hryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeasea
    ylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1p3oF (F:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggakrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3oF (F:)
    dniqgitkpairrlarrggakrisgliyeetrgvlkvflenvirdavtytehakrktvta
    mdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1p3oG (G:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    esaksaksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3oG (G:)
    aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
    kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1p3oH (H:)
    pepaksapapkkgskkavtktqkkdgkkrrksrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3oH (H:)
    kesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsre
    iqtavrlllpgelakhavsegtkavtkytsak