PDB entry 1p3e

View 1p3e on RCSB PDB site
Description: Structure of Glu endopeptidase in complex with MPD
Class: hydrolase
Keywords: serine protease, Glu specific, HYDROLASE
Deposited on 2003-04-17, released 2004-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.168
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamyl-endopeptidase
    Species: Bacillus intermedius [TaxId:1400]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p3ea_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p3eA (A:)
    vvigddgrtkvantrvapynsiayitfggssctgtliapnkiltnghcvyntasrsysak
    gsvypgmndstavngsanmtefyvpsgyintgasqydfaviktdtnigntvgyrsirqvt
    nltgttikisgypgdkmrstgkvsqwemsgsvtredtnlayytidtfsgnsgsamldqnq
    qivgvhnagysngtinggpkataafvefinyakaq