PDB entry 1p3c

View 1p3c on RCSB PDB site
Description: Glutamyl endopeptidase from Bacillus intermedius
Class: hydrolase
Keywords: serine protease, HYDROLASE
Deposited on 2003-04-17, released 2004-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.156
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamyl-endopeptidase
    Species: Bacillus intermedius [TaxId:1400]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p3ca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1p3cA (A:)
vvigddgrtkvantrvapynsiayitfggssctgtliapnkiltnghcvyntasrsysak
gsvypgmndstavngsanmtefyvpsgyintgasqydfaviktdtnigntvgyrsirqvt
nltgttikisgypgdkmrstgkvsqwemsgsvtredtnlayytidtfsgnsgsamldqnq
qivgvhnagysngtinggpkataafvefinyakaq