PDB entry 1p3c

View 1p3c on RCSB PDB site
Description: Glutamyl endopeptidase from Bacillus intermedius
Deposited on 2003-04-17, released 2004-04-27
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-27, with a file datestamp of 2004-04-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.156
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1p3ca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1p3cA (A:)
vvigddgrtkvantrvapynsiayitfggssctgtliapnkiltnghcvyntasrsysak
gsvypgmndstavngsanmtefyvpsgyintgasqydfaviktdtnigntvgyrsirqvt
nltgttikisgypgdkmrstgkvsqwemsgsvtredtnlayytidtfsgnsgsamldqnq
qivgvhnagysngtinggpkataafvefinyakaq