PDB entry 1p3b

View 1p3b on RCSB PDB site
Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
Class: structural protein/DNA
Keywords: Sin mutants,Nucleosome Core Particle, chromatin, protein/DNA interaction, STRUCTURAL PROTEIN/DNA COMPLEX
Deposited on 2003-04-17, released 2004-02-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.219
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone h3
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7ZT64
      • conflict (101)
    Domains in SCOPe 2.06: d1p3ba_
  • Chain 'B':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62799
      • conflict (44)
    Domains in SCOPe 2.06: d1p3bb_
  • Chain 'C':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7ZT66
      • conflict (13)
      • conflict (66-73)
      • conflict (75-87)
    Domains in SCOPe 2.06: d1p3bc_
  • Chain 'D':
    Compound: histone h2b
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281
      • conflict (44)
      • conflict (59)
      • conflict (68)
    Domains in SCOPe 2.06: d1p3bd_
  • Chain 'E':
    Compound: histone h3
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7ZT64 (Start-134)
      • conflict (101)
    Domains in SCOPe 2.06: d1p3be_
  • Chain 'F':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62799 (Start-101)
      • conflict (44)
    Domains in SCOPe 2.06: d1p3bf_
  • Chain 'G':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7ZT66
      • conflict (66-73)
      • conflict (75-87)
    Domains in SCOPe 2.06: d1p3bg_
  • Chain 'H':
    Compound: histone h2b
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-124)
      • conflict (44)
      • conflict (59)
      • conflict (68)
    Domains in SCOPe 2.06: d1p3bh_
  • Chain 'I':
    Compound: Palindromic 146bp Human Alpha-Satellite DNA fragment
    Species: Homo sapiens [TaxId:9606]
  • Chain 'J':
    Compound: Palindromic 146bp Human Alpha-Satellite DNA fragment
    Species: Homo sapiens [TaxId:9606]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p3bA (A:)
    artkqtarkstggkaprkqlatkaarksapatgeskkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3bA (A:)
    kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
    eaylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p3bB (B:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkaisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3bB (B:)
    niqgitkpairrlarrggvkaisgliyeetrgvlkvflenvirdavtytehakrktvtam
    dvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p3bC (C:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    esaksaksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3bC (C:)
    kaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaard
    nkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1p3bD (D:)
    pepaksapapkkgskkavtktqkkdgkkrrksrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3bD (D:)
    srkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits
    reiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1p3bE (E:)
    artkqtarkstggkaprkqlatkaarksapatgeskkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3bE (E:)
    kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
    eaylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1p3bF (F:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkaisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3bF (F:)
    lrdniqgitkpairrlarrggvkaisgliyeetrgvlkvflenvirdavtytehakrktv
    tamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1p3bG (G:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    esaksaksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3bG (G:)
    ktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
    ktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1p3bH (H:)
    pepaksapapkkgskkavtktqkkdgkkrrksrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3bH (H:)
    kesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsre
    iqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.