PDB entry 1p38

View 1p38 on RCSB PDB site
Description: the structure of the map kinase p38 at 2.1 angstoms resolution
Class: transferase
Keywords: transferase, map kinase, serine/threonine-protein kinase, p38
Deposited on 1997-01-06, released 1998-01-21
Made obsolete by 5uoj on 2017-02-22

The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: map kinase p38
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p38a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p38A (A:)
    gsshhhhhhssglvprgshmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaa
    fdtktghrvavkklsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefnd
    vylvthlmgadlnnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavned
    celkildfglarhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrt
    lfpgtdhidqlklilrlvgtpgaellkkissesarnyiqslaqmpkmnfanvfiganpla
    vdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdllidewkslt
    ydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p38A (A:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
    atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
    aellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
    ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld