PDB entry 1p33

View 1p33 on RCSB PDB site
Description: Pteridine reductase from Leishmania tarentolae complex with NADPH and MTX
Class: oxidoreductase
Keywords: Pteridine reductase, complex, NADPH, crystal structure, MTX, OXIDOREDUCTASE
Deposited on 2003-04-16, released 2003-09-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: 0.213
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pteridine reductase 1
    Species: Leishmania tarentolae [TaxId:5689]
    Gene: PTR1 OR LTDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1p33a_
  • Chain 'B':
    Compound: pteridine reductase 1
    Species: Leishmania tarentolae [TaxId:5689]
    Gene: PTR1 OR LTDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1p33b_
  • Chain 'C':
    Compound: pteridine reductase 1
    Species: Leishmania tarentolae [TaxId:5689]
    Gene: PTR1 OR LTDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1p33c_
  • Chain 'D':
    Compound: pteridine reductase 1
    Species: Leishmania tarentolae [TaxId:5689]
    Gene: PTR1 OR LTDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1p33d_
  • Heterogens: NDP, MTX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p33A (A:)
    mttsptapvalvtgaakrlgssiaealhaegytvclhyhrsaadastlaatlnarrpnsa
    itvqadlsnvatasfsetdgsvpvtlfsrcsalvdacymhwgrcdvlvnnassfyptpll
    rkdageggssvgdkeslevaaadlfgsnaiapyflikafaqrvadtraeqrgtsysivnm
    vdamtsqpllgytmytmakealegltrsaalelaslqirvngvspglsvlpddmpfsvqe
    dyrrkvplyqrnssaeevsdvviflcspkakyitgtcikvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p33A (A:)
    tapvalvtgaakrlgssiaealhaegytvclhyhrsaadastlaatlnarrpnsaitvqa
    dlsnvatassvpvtlfsrcsalvdacymhwgrcdvlvnnassfyptpllrdkeslevaaa
    dlfgsnaiapyflikafaqrvadtraeqrgtsysivnmvdamtsqpllgytmytmakeal
    egltrsaalelaslqirvngvspglsvlpddmpfsvqedyrrkvplyqrnssaeevsdvv
    iflcspkakyitgtcikvdggysltra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p33B (B:)
    mttsptapvalvtgaakrlgssiaealhaegytvclhyhrsaadastlaatlnarrpnsa
    itvqadlsnvatasfsetdgsvpvtlfsrcsalvdacymhwgrcdvlvnnassfyptpll
    rkdageggssvgdkeslevaaadlfgsnaiapyflikafaqrvadtraeqrgtsysivnm
    vdamtsqpllgytmytmakealegltrsaalelaslqirvngvspglsvlpddmpfsvqe
    dyrrkvplyqrnssaeevsdvviflcspkakyitgtcikvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p33B (B:)
    sptapvalvtgaakrlgssiaealhaegytvclhyhrsaadastlaatlnarrpnsaitv
    qadlsnvatassvpvtlfsrcsalvdacymhwgrcdvlvnnassfyptpllrkkesleva
    aadlfgsnaiapyflikafaqrvadtraeqrgtsysivnmvdamtsqpllgytmytmake
    alegltrsaalelaslqirvngvspglsvlpddmpfsvqedyrrkvplyqrnssaeevsd
    vviflcspkakyitgtcikvdggysltra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p33C (C:)
    mttsptapvalvtgaakrlgssiaealhaegytvclhyhrsaadastlaatlnarrpnsa
    itvqadlsnvatasfsetdgsvpvtlfsrcsalvdacymhwgrcdvlvnnassfyptpll
    rkdageggssvgdkeslevaaadlfgsnaiapyflikafaqrvadtraeqrgtsysivnm
    vdamtsqpllgytmytmakealegltrsaalelaslqirvngvspglsvlpddmpfsvqe
    dyrrkvplyqrnssaeevsdvviflcspkakyitgtcikvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p33C (C:)
    ptapvalvtgaakrlgssiaealhaegytvclhyhrsaadastlaatlnarrpnsaitvq
    adlsnvatassvpvtlfsrcsalvdacymhwgrcdvlvnnassfyptpllrkkeslevaa
    adlfgsnaiapyflikafaqrvadtraeqrgtsysivnmvdamtsqpllgytmytmakea
    legltrsaalelaslqirvngvspglsvlpddmpfsvqedyrrkvplyqrnssaeevsdv
    viflcspkakyitgtcikvdggysltra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1p33D (D:)
    mttsptapvalvtgaakrlgssiaealhaegytvclhyhrsaadastlaatlnarrpnsa
    itvqadlsnvatasfsetdgsvpvtlfsrcsalvdacymhwgrcdvlvnnassfyptpll
    rkdageggssvgdkeslevaaadlfgsnaiapyflikafaqrvadtraeqrgtsysivnm
    vdamtsqpllgytmytmakealegltrsaalelaslqirvngvspglsvlpddmpfsvqe
    dyrrkvplyqrnssaeevsdvviflcspkakyitgtcikvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p33D (D:)
    tapvalvtgaakrlgssiaealhaegytvclhyhrsaadastlaatlnarrpnsaitvqa
    dlsnvatassvpvtlfsrcsalvdacymhwgrcdvlvnnassfyptpllrkdkeslevaa
    adlfgsnaiapyflikafaqrvadtraeqrgtsysivnmvdamtsqpllgytmytmakea
    legltrsaalelaslqirvngvspglsvlpddmpfsvqedyrrkvplyqrnssaeevsdv
    viflcspkakyitgtcikvdggysltra