PDB entry 1p31

View 1p31 on RCSB PDB site
Description: Crystal Structure of UDP-N-acetylmuramic acid:L-alanine Ligase (MurC) from Haemophilus influenzae
Class: ligase
Keywords: alpha/beta protein, LIGASE
Deposited on 2003-04-16, released 2003-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.171
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-N-acetylmuramate--alanine ligase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: murC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45066
      • modified residue (14)
      • modified residue (30)
      • modified residue (109)
      • modified residue (114)
      • modified residue (134)
      • modified residue (137)
      • modified residue (186)
      • modified residue (193)
      • modified residue (198)
      • modified residue (208)
      • modified residue (227)
      • modified residue (235)
      • modified residue (370)
      • modified residue (399)
    Domains in SCOPe 2.06: d1p31a1, d1p31a2, d1p31a3
  • Chain 'B':
    Compound: UDP-N-acetylmuramate--alanine ligase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: murC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45066
      • modified residue (14)
      • modified residue (30)
      • modified residue (109)
      • modified residue (114)
      • modified residue (134)
      • modified residue (137)
      • modified residue (186)
      • modified residue (193)
      • modified residue (198)
      • modified residue (208)
      • modified residue (227)
      • modified residue (235)
      • modified residue (370)
      • modified residue (399)
    Domains in SCOPe 2.06: d1p31b1, d1p31b2, d1p31b3
  • Heterogens: MG, EPU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p31A (A:)
    mkhsheeirkiipemrrvqqihfigiggagmsgiaeillnegyqisgsdiadgvvtqrla
    qagakiyighaeehiegasvvvvssaikddnpelvtskqkripviqraqmlaeimrfrhg
    iavagthgkttttamismiytqakldptfvngglvksagknahlgasryliaeadesdas
    flhlqpmvsvvtnmepdhmdtyegdfekmkatyvkflhnlpfyglavmcaddpvlmelvp
    kvgrqvitygfseqadyriedyeqtgfqghytvicpnnerinvllnvpgkhnalnataal
    avakeegianeailealadfqgagrrfdqlgefirpngkvrlvddyghhptevgvtikaa
    regwgdkrivmifqphrysrtrdlfddfvqvlsqvdalimldvyaageapivgadskslc
    rsirnlgkvdpilvsdtsqlgdvldqiiqdgdlilaqgagsvskisrglaeswkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p31A (A:)
    ipemrrvqqihfigiggagmsgiaeillnegyqisgsdiadgvvtqrlaqagakiyigha
    eehiegasvvvvssaikddnpelvtskqkripviqraqmlaeimrfrhgiavagthgktt
    ttamismiytqakldptfvngglvksagknahlgasryliaeadesdasflhlqpmvsvv
    tnmepdhmdtyegdfekmkatyvkflhnlpfyglavmcaddpvlmelvpkvgrqvitygf
    seqadyriedyeqtgfqghytvicpnnerinvllnvpgkhnalnataalavakeegiane
    ailealadfqgagrrfdqlgefirpngkvrlvddyghhptevgvtikaaregwgdkrivm
    ifqphrysrtrdlfddfvqvlsqvdalimldvyaageapivgadskslcrsirnlgkvdp
    ilvsdtsqlgdvldqiiqdgdlilaqgagsvskisrglaeswk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p31B (B:)
    mkhsheeirkiipemrrvqqihfigiggagmsgiaeillnegyqisgsdiadgvvtqrla
    qagakiyighaeehiegasvvvvssaikddnpelvtskqkripviqraqmlaeimrfrhg
    iavagthgkttttamismiytqakldptfvngglvksagknahlgasryliaeadesdas
    flhlqpmvsvvtnmepdhmdtyegdfekmkatyvkflhnlpfyglavmcaddpvlmelvp
    kvgrqvitygfseqadyriedyeqtgfqghytvicpnnerinvllnvpgkhnalnataal
    avakeegianeailealadfqgagrrfdqlgefirpngkvrlvddyghhptevgvtikaa
    regwgdkrivmifqphrysrtrdlfddfvqvlsqvdalimldvyaageapivgadskslc
    rsirnlgkvdpilvsdtsqlgdvldqiiqdgdlilaqgagsvskisrglaeswkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p31B (B:)
    rkiipemrrvqqihfigiggagmsgiaeillnegyqisgsdiadgvvtqrlaqagakiyi
    ghaeehiegasvvvvssaikddnpelvtskqkripviqraqmlaeimrfrhgiavagthg
    kttttamismiytqakldptfvngglvksagknahlgasryliaeadesdasflhlqpmv
    svvtnmepdhmdtyegdfekmkatyvkflhnlpfyglavmcaddpvlmelvpkvgrqvit
    ygfseqadyriedyeqtgfqghytvicpnnerinvllnvpgkhnalnataalavakeegi
    aneailealadfqgagrrfdqlgefirpngkvrlvddyghhptevgvtikaaregwgdkr
    ivmifqphrysrtrdlfddfvqvlsqvdalimldvyaageapivgadskslcrsirnlgk
    vdpilvsdtsqlgdvldqiiqdgdlilaqgagsvskisrglaesw