PDB entry 1p30

View 1p30 on RCSB PDB site
Description: refinement of adenovirus type 5 hexon with cns
Deposited on 2003-04-16, released 2003-11-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-11, with a file datestamp of 2003-11-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.158
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p30A (A:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginitk
    egiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakpt
    nenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthis
    ymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdl
    qdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggvi
    ntetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialyl
    pdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrna
    glryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndl
    rvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanat
    nvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkv
    aitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgf
    yipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqa
    ypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahal
    dmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p30A (A:)
    mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
    lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
    pkgapnpcewdthvfgqapysginitkegiqigvegqtpkyadktfqpepqigesqwyet
    einhaagrvlkkttpmkpcygsyakptnenggqgilvlesqvemqffstteltpkvvlys
    edvdietpdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvl
    agqasqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgted
    elpnycfplggvintetltkvkpgwekdafsdkneirvgnnfameinlnanlwrnflysn
    ialylpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfn
    hhrnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqss
    lgndlrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypi
    panatnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnh
    tfkkvaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanyni
    gyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptm
    regqaypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyan
    sahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsa