PDB entry 1p2z

View 1p2z on RCSB PDB site
Description: Refinement of Adenovirus Type 2 Hexon with CNS
Class: Viral protein
Keywords: ADENOVIRUS, TYPE 2, HEXON, VIRUS, JELLYROLL, COAT PROTEIN, Viral protein
Deposited on 2003-04-16, released 2003-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.178
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hexon protein
    Species: Human adenovirus 2 [TaxId:10515]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p2za1, d1p2za2
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p2zA (A:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnsceweqtedsgravaedeeeededeeeeeeeqnardqatkkthvyaqapl
    sgetitksglqigsdnaetqakpvyadpsyqpepqigesqwneadanaaggrvlkkttpm
    kpcygsyarptnpfggqsvlvpdekgvplpkvdlqffsnttslndrqgnatkpkvvlyse
    dvnmetpdthlsykpgkgdenskamlgqqsmpnrpnyiafrdnfiglmyynstgnmgvla
    gqasqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtede
    lpnycfplggigvtdtyqaikangngsgdngdttwtkdetfatrneigvgnnfameinln
    anlwrnflysnialylpdklkynptnveisdnpntydymnkrvvapglvdcyinlgarws
    ldymdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnf
    rkdvnmvlqsslgndlrvdgasikfdsiclyatffpmahntastleamlrndtndqsfnd
    ylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsi
    pyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdw
    flvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykeyqqvgilhqhnn
    sgfvgylaptmregqaypanvpypligktavdsitqkkflcdrtlwripfssnfmsmgal
    tdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhqphrgvietvylrtpf
    sagnatt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p2zA (A:)
    mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
    lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
    pkgapnsceweqthvyaqaplsgetitksglqigpvyadpsyqpepqigesqwneadana
    aggrvlkkttpmkpcygsyarptnpfggqsvlvlpkvdlqffsnatkpkvvlysedvnme
    tpdthlsykpgkgdenskamlgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasq
    lnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnyc
    fplggigvtdtyqaikattwtkdetfatrneigvgnnfameinlnanlwrnflysnialy
    lpdklkynptnveisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrn
    aglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgnd
    lrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipana
    tnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkk
    vaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqg
    fyipesykdrmysffrnfqpmsrqvvddtkykeyqqvgilhqhnnsgfvgylaptmregq
    aypanvpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansaha
    ldmtfevdpmdeptllyvlfevfdvvrvhqphrgvietvylrtpfsa