PDB entry 1p2x

View 1p2x on RCSB PDB site
Description: crystal structure of the calponin-homology domain of rng2 from schizosaccharomyces pombe
Class: protein binding
Keywords: 4 helices, bundle, protein binding
Deposited on 2003-04-16, released 2004-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.206
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras GTPase-activating-like protein
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: RNG2 OR SPAC4F8.13C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p2xa_
  • Heterogens: BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1p2xA (A:)
retlqaydylcrvdeakkwieeclgtdlgptstfeqslrngvvlallvqkfqpdklikif
ysnelqfrhsdninkfldfihgiglpeifhfeltdiyegknlpkviycihalsyflsmqd
lappliksdenlsftdedvsiivrrlrqsnvilpnfkal