PDB entry 1p2p

View 1p2p on RCSB PDB site
Description: structure of porcine pancreatic phospholipase a2 at 2.6 angstroms resolution and comparison with bovine phospholipase a2
Deposited on 1983-06-27, released 1983-09-15
The last revision prior to the SCOP 1.71 freeze date was dated 1983-09-30, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.6 Å
R-factor: 0.241
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d1p2p__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p2p_ (-)
  alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
  ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
  kkyc