PDB entry 1p2p

View 1p2p on RCSB PDB site
Description: structure of porcine pancreatic phospholipase a2 at 2.6 angstroms resolution and comparison with bovine phospholipase a2
Class: carboxylic ester hydrolase
Keywords: carboxylic ester hydrolase
Deposited on 1983-06-27, released 1983-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p2pa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p2pA (A:)
    alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
    ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
    kkyc