PDB entry 1p2k

View 1p2k on RCSB PDB site
Description: Structural consequences of accommodation of four non-cognate amino-acid residues in the S1 pocket of bovine trypsin and chymotrypsin
Class: hydrolase/hydrolase inhibitor
Keywords: trypsin; chymotrypsin; serine proteinase; bovine pancreatic trypsin inhibitor; protein-protein interaction; non-cognate binding; S1 pocket; primary specificity; crystal structure, hydrolase/hydrolase inhibitor COMPLEX
Deposited on 2003-04-15, released 2004-04-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: trypsinogen, cationic
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00760 (0-222)
  Domains in SCOPe 2.08: d1p2ka_
• Chain 'I':
  Compound: pancreatic trypsin inhibitor
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00974 (0-57)
    • engineered (14)
    • engineered (51)
  Domains in SCOPe 2.08: d1p2ki_
• Heterogens: CA, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p2kA (A:)
  ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
  neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
  wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
  vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
  

  
  
• Chain 'I':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p2kI (I:)
  rpdfcleppytgpcvariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga