PDB entry 1p2b

View 1p2b on RCSB PDB site
Description: Crystal Structure of Glycogen Phosphorylase B in Complex with Maltoheptaose
Class: transferase
Keywords: transferase
Deposited on 2003-04-15, released 2003-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • see remark 999 (379)
    Domains in SCOPe 2.07: d1p2ba_
  • Heterogens: GLC, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p2bA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p2bA (A:)
    qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
    qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
    gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
    arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
    lgyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksstnfda
    fpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvipealerwp
    vhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciag
    shavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerig
    eeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvk
    riheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigd
    vvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngalt
    igtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssg
    ffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniats
    gkfssdrtiaqyareiwgvepsrqrlpa