PDB entry 1p28

View 1p28 on RCSB PDB site
Description: The crystal structure of a pheromone binding protein from the cockroach Leucophaea maderae in complex with a component of the pheromonal blend: 3-hydroxy-butan-2-one.
Class: transport protein
Keywords: Pheromone binding protein, 3-hydroxy-butan-2-one, transport protein
Deposited on 2003-04-15, released 2003-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.145
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pheromone binding protein
    Species: Leucophaea maderae [TaxId:6988]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8MTC1
      • cloning artifact (9-10)
    Domains in SCOPe 2.07: d1p28a1, d1p28a2
  • Chain 'B':
    Compound: pheromone binding protein
    Species: Leucophaea maderae [TaxId:6988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p28b_
  • Heterogens: HBS, HBR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p28A (A:)
    mdiginsdpnsstqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacal
    dkvglispegaiytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdlikn
    ftdcvrnsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p28A (A:)
    nsstqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispe
    gaiytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p28B (B:)
    mdiginsdpnsstqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacal
    dkvglispegaiytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdlikn
    ftdcvrnsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p28B (B:)
    tqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispegai
    ytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy