PDB entry 1p1z

View 1p1z on RCSB PDB site
Description: x-ray crystal structure of the lectin-like natural killer cell receptor ly-49c bound to its mhc class i ligand h-2kb
Deposited on 2003-04-14, released 2003-11-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-09, with a file datestamp of 2003-12-09.
Experiment type: XRAY
Resolution: 3.26 Å
R-factor: 0.263
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p1zA (A:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1zA (A:)
    hslryfvtavsrpglgeprymevgyvddtefvyeprarwmeqegpeyweretqkakgneq
    sfrvdlrtllgyynqskggshtiqvisgcevrgyqqyaydgcdyialnedlktwtaadma
    alitkhkweqageaerlraylegtcvewlrrylkngnatllrtdspkahvthhsrpedkv
    tlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtfqkwasvvvplgkeqyytc
    hvyhqglpepltlrw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p1zB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1zB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemssfskdwsf
    yilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1p1zD (D:)
    gvvywfcystkcyyfimnkttwsgckancqhysvpilkiededelkflqrhvipenywig
    lsydkkkkewawidngpskldmkirkmnfksrgcvflskariedidcnipyycicgkkld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1zD (D:)
    vywfcystkcyyfimnkttwsgckancqhysvpilkiededelkflqrhvipenywigls
    ydkkkkewawidngpskldmkirkmnfksrgcvflskariedidcnipyycicgkkld