PDB entry 1p1z

View 1p1z on RCSB PDB site
Description: X-RAY CRYSTAL STRUCTURE OF THE LECTIN-LIKE NATURAL KILLER CELL RECEPTOR LY-49C BOUND TO ITS MHC CLASS I LIGAND H-2Kb
Class: immune system
Keywords: NK, Kb, MHC, Antigenic Peptide, Ly49, OVA, IMMUNE SYSTEM
Deposited on 2003-04-14, released 2003-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.26 Å
R-factor: 0.263
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-K
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p1za1, d1p1za2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p1zb_
  • Chain 'D':
    Compound: LY49-C antigen
    Species: Mus musculus [TaxId:10090]
    Gene: KLRA3 OR LY49C OR LY-49C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64329 (Start-119)
      • conflict (2)
    Domains in SCOPe 2.07: d1p1zd_
  • Chain 'P':
    Compound: Ovalbumin peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p1zA (A:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1zA (A:)
    hslryfvtavsrpglgeprymevgyvddtefvyeprarwmeqegpeyweretqkakgneq
    sfrvdlrtllgyynqskggshtiqvisgcevrgyqqyaydgcdyialnedlktwtaadma
    alitkhkweqageaerlraylegtcvewlrrylkngnatllrtdspkahvthhsrpedkv
    tlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtfqkwasvvvplgkeqyytc
    hvyhqglpepltlrw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p1zB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1zB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemssfskdwsf
    yilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1p1zD (D:)
    gvvywfcystkcyyfimnkttwsgckancqhysvpilkiededelkflqrhvipenywig
    lsydkkkkewawidngpskldmkirkmnfksrgcvflskariedidcnipyycicgkkld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1zD (D:)
    vywfcystkcyyfimnkttwsgckancqhysvpilkiededelkflqrhvipenywigls
    ydkkkkewawidngpskldmkirkmnfksrgcvflskariedidcnipyycicgkkld
    

  • Chain 'P':
    No sequence available.