PDB entry 1p1x

View 1p1x on RCSB PDB site
Description: Comparison of class I aldolase binding site architecture based on the crystal structure of 2-deoxyribose-5-phosphate aldolase determined at 0.99 Angstrom resolution
Class: lyase
Keywords: alpha-beta barrel, TIM barrel, LYASE
Deposited on 2003-04-14, released 2004-06-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 0.99 Å
R-factor: 0.143
AEROSPACI score: 1.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyribose-phosphate aldolase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b4381, deoC, DEOC OR DRA OR THYR OR B4381 OR C5465, dra, JW4344, thyR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p1xa_
  • Chain 'B':
    Compound: deoxyribose-phosphate aldolase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b4381, deoC, DEOC OR DRA OR THYR OR B4381 OR C5465, dra, JW4344, thyR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6L0 (0-End)
      • expression tag (0)
    Domains in SCOPe 2.06: d1p1xb1, d1p1xb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p1xA (A:)
    hmtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarkt
    lkeqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgf
    dlvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatp
    esarimmevirdmgvektvgfkpaggvrtaedaqkylaiadelfgadwadarhyrfgass
    llasllkalghgdgksassy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1xA (A:)
    mtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarktl
    keqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgfd
    lvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatpe
    sarimmevirdmgvektvgfkpaggvrtaedaqkylaiadelfgadwadarhyrfgassl
    lasllkalgh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p1xB (B:)
    hmtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarkt
    lkeqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgf
    dlvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatp
    esarimmevirdmgvektvgfkpaggvrtaedaqkylaiadelfgadwadarhyrfgass
    llasllkalghgdgksassy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1xB (B:)
    hmtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarkt
    lkeqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgf
    dlvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatp
    esarimmevirdmgvektvgfkpaggvrtaedaqkylaiadelfgadwadarhyrfgass
    llasllkalgh