PDB entry 1p1t

View 1p1t on RCSB PDB site
Description: nmr structure of the n-terminal rrm domain of cleavage stimulation factor 64 kda subunit
Deposited on 2003-04-14, released 2003-08-12
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-12, with a file datestamp of 2003-08-12.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1p1ta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p1tA (A:)
  dpavdrslrsvfvgnipyeateeqlkdifsevgpvvsfrlvydretgkpkgygfceyqdq
  etalsamrnlngrefsgralrvdnaaseknkeelkslgtgapvi