PDB entry 1p1l

View 1p1l on RCSB PDB site
Description: Structure of the Periplasmic divalent cation tolerance protein CutA from Archaeoglobus fulgidus
Class: structural genomics, unknown function
Keywords: T835, NYSGXRC, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2003-04-12, released 2003-04-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Periplasmic divalent cation tolerance protein cutA
  Species: Archaeoglobus fulgidus [TaxId:2234]
  Gene: CUTA
  Database cross-references and differences (RAF-indexed):
  • Uniprot O28301 (0-101)
  Domains in SCOPe 2.03: d1p1la_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p1lA (A:)
  mhnfiyitapsleeaeriakrllekklaacvnifpiksffwwegkieaatefamivktrs
  ekfaevrdevkamhsyttpcicaipierglkefldwidetve