PDB entry 1p1l

View 1p1l on RCSB PDB site
Description: structure of the periplasmic divalent cation tolerance protein cuta from archaeoglobus fulgidus
Deposited on 2003-04-12, released 2003-04-29
The last revision prior to the SCOP 1.67 freeze date was dated 2003-04-29, with a file datestamp of 2003-04-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1p1la_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p1lA (A:)
  mhnfiyitapsleeaeriakrllekklaacvnifpiksffwwegkieaatefamivktrs
  ekfaevrdevkamhsyttpcicaipierglkefldwidetve