PDB entry 1p1k

View 1p1k on RCSB PDB site
Description: Crystal structure of the 1L-myo-inositol 1-phosphate synthase complexed with NADH in the presence of EDTA
Deposited on 2003-04-12, released 2003-07-08
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-08, with a file datestamp of 2003-07-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p1kA (A:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1kA (A:)
    itsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgi
    mliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvya
    pfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyyp
    dfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtante
    ryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvql
    aehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrs
    keiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghn
    risihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypvltflsywl
    kapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p1kB (B:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1kB (B:)
    tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim
    liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap
    fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd
    fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter
    yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla
    ehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrsk
    eividdiiasndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisih
    nvcedsllatpliidllvmtefctrvsykkvkfenfypvltflsywlkapltrpgfhpvn
    glnkqrtalenflrlliglpsqnelrfeerll