PDB entry 1p1i

View 1p1i on RCSB PDB site
Description: Crystal structure of the NAD+-bound 1L-myo-inositol 1-phosphate synthase
Class: isomerase
Keywords: NAD+, 1L-myo-inositol 1-phosphate, isomerase
Deposited on 2003-04-12, released 2003-07-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.209
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inositol-3-phosphate synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11986 (Start-532)
      • see remark 999 (13)
      • see remark 999 (59)
      • see remark 999 (97)
      • see remark 999 (139-140)
      • see remark 999 (200)
      • see remark 999 (443)
    Domains in SCOPe 2.06: d1p1ia1, d1p1ia2
  • Chain 'B':
    Compound: Inositol-3-phosphate synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11986 (Start-532)
      • see remark 999 (13)
      • see remark 999 (59)
      • see remark 999 (97)
      • see remark 999 (139-140)
      • see remark 999 (200)
      • see remark 999 (443)
    Domains in SCOPe 2.06: d1p1ib1, d1p1ib2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p1iA (A:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1iA (A:)
    itsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgi
    mliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvya
    pfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyyp
    dfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtante
    ryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvql
    aehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndviddiiasndil
    yndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvcedsllatplii
    dllvmtefctrvsykkvdpvkedagkfenfypvltflsywlkapltrpgfhpvnglnkqr
    talenflrlliglpsqnelrfeerll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p1iB (B:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1iB (B:)
    tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim
    liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap
    fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd
    fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter
    yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla
    ehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgiiasndilyndklgkk
    vdhcivikymkpvgdskvamdeyyselmlgghnrisihnvcedsllatpliidllvmtef
    ctrvsykkvdpvkedagkfenfypvltflsywlkapltrpgfhpvnglnkqrtalenflr
    lliglpsqnelrfeerll