PDB entry 1p1h

View 1p1h on RCSB PDB site
Description: Crystal structure of the 1L-myo-inositol/NAD+ complex
Deposited on 2003-04-12, released 2003-07-08
The last revision prior to the SCOP 1.67 freeze date was dated 2003-07-08, with a file datestamp of 2003-07-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.208
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p1hA (A:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1hA (A:)
    tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim
    liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap
    fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd
    fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter
    yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla
    ehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynlsiiasndil
    yndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvcedsllatplii
    dllvmtefctrvsykkvdpvkedagkfenfypvltflsywlkapltrpgfhpvnglnkqr
    talenflrlliglpsqnelrfeerll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p1hB (B:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1hB (B:)
    tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim
    liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap
    fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd
    fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter
    yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla
    ehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndsndilyndklgkk
    vdhcivikymkpvgdskvamdeyyselmlgghnrisihnvcedsllatpliidllvmtef
    ctrvsykkvgkfenfypvltflsywlkapltrpgfhpvnglnkqrtalenflrlliglps
    qnelrfeerll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p1hC (C:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1hC (C:)
    tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim
    liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap
    fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd
    fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter
    yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla
    ehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrsk
    eiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnr
    isihnvcedsllatpliidllvmtefctrvsykkvdkfenfypvltflsywlkapltrpg
    fhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1p1hD (D:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1hD (D:)
    tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim
    liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap
    fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd
    fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter
    yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla
    ehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynlsiiasndil
    ynddskvamdeyyselmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdp
    vkedagkfenfypvltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnel
    rfeerll