PDB entry 1p1f

View 1p1f on RCSB PDB site
Description: Crystal structure of apo 1L-myo-inositol 1-phosphate synthase
Deposited on 2003-04-12, released 2003-07-08
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-08, with a file datestamp of 2003-07-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.19
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p1fA (A:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1fA (A:)
    itsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgi
    mliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvya
    pfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyyp
    dfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtante
    ryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvql
    aehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhviddiiasndilyndkl
    gkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvcedsllatpliidllvm
    tefctrvsykkvdpvkedagkfenfypvltflsywlkapltrpgfhpvnglnkqrtalen
    flrlliglpsqnelrfeerll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p1fB (B:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1fB (B:)
    itsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgi
    mliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvya
    pfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyyp
    dfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtante
    ryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvql
    aehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlviddiiasndilyndk
    lgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvcedsllatpliidllv
    mtefctrvsykkvdpkfenfypvltflsywlkapltrpgfhpvnglnkqrtalenflrll
    iglpsqnelrfeerll