PDB entry 1p1f

View 1p1f on RCSB PDB site
Description: Crystal structure of apo 1L-myo-inositol 1-phosphate synthase
Class: isomerase
Keywords: apo, enzyme, ISOMERASE
Deposited on 2003-04-12, released 2003-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.19
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inositol-3-phosphate synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11986 (Start-532)
      • see remark 999 (13)
      • see remark 999 (59)
      • see remark 999 (97)
      • see remark 999 (139-140)
      • see remark 999 (200)
      • see remark 999 (443)
    Domains in SCOPe 2.07: d1p1fa1, d1p1fa2
  • Chain 'B':
    Compound: Inositol-3-phosphate synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11986 (Start-532)
      • see remark 999 (13)
      • see remark 999 (59)
      • see remark 999 (97)
      • see remark 999 (139-140)
      • see remark 999 (200)
      • see remark 999 (443)
    Domains in SCOPe 2.07: d1p1fb1, d1p1fb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p1fA (A:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1fA (A:)
    itsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgi
    mliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvya
    pfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyyp
    dfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtante
    ryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvql
    aehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhviddiiasndilyndkl
    gkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvcedsllatpliidllvm
    tefctrvsykkvdpvkedagkfenfypvltflsywlkapltrpgfhpvnglnkqrtalen
    flrlliglpsqnelrfeerll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p1fB (B:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p1fB (B:)
    itsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgi
    mliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvya
    pfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyyp
    dfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtante
    ryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvql
    aehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlviddiiasndilyndk
    lgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvcedsllatpliidllv
    mtefctrvsykkvdpkfenfypvltflsywlkapltrpgfhpvnglnkqrtalenflrll
    iglpsqnelrfeerll