PDB entry 1p1e

View 1p1e on RCSB PDB site
Description: Structural Insights into the Inter-domain Chaperoning of Tandem PDZ Domains in Glutamate Receptor Interacting Proteins
Class: protein binding
Keywords: PDZ domain, Glutamate Receptor, chaperoning domain, PROTEIN BINDING
Deposited on 2003-04-12, released 2003-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor interacting protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p1ea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p1eA (A:)
    qvvhtettevvltadpvtgfgiqlqgsvfatetlsspplisyieadspaercgvlqigdr
    vmaingiptedstfeeanqllrdssitskvtleiefdvaes